Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDKN1B monoclonal antibody (M01), clone 4B4-E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
More info about CDKN1B monoclonal antibody (M01), clone 4B4-E6
| Brand: | Abnova |
| Reference: | H00001027-M01 |
| Product name: | CDKN1B monoclonal antibody (M01), clone 4B4-E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CDKN1B. |
| Clone: | 4B4-E6 |
| Isotype: | IgG1 kappa |
| Gene id: | 1027 |
| Gene name: | CDKN1B |
| Gene alias: | CDKN4|KIP1|MEN1B|MEN4|P27KIP1 |
| Gene description: | cyclin-dependent kinase inhibitor 1B (p27, Kip1) |
| Genbank accession: | BC001971 |
| Immunogen: | CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
| Protein accession: | AAH01971 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Increase of Intracellular Cyclic Amp by PDE4 Inhibitors Affects HepG2 Cell Cycle Progression and Survival.Massimi M, Cardarelli S, Galli F, Giardi MF, Ragusa F, Panera N, Cinque B, Cifone MG, Biagioni S, Giorgi M. J Cell Biochem. 2016 Nov 16. [Epub ahead of print] |