Brand: | Abnova |
Reference: | H00001024-M04 |
Product name: | CDK8 monoclonal antibody (M04), clone 2E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK8. |
Clone: | 2E6 |
Isotype: | IgG1 Kappa |
Gene id: | 1024 |
Gene name: | CDK8 |
Gene alias: | K35|MGC126074|MGC126075 |
Gene description: | cyclin-dependent kinase 8 |
Genbank accession: | NM_001260 |
Immunogen: | CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY |
Protein accession: | NP_001251 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | CDK8 monoclonal antibody (M04), clone 2E6 Western Blot analysis of CDK8 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |