CDK7 (Human) Recombinant Protein (Q01) View larger

CDK7 (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK7 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CDK7 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00001022-Q01
Product name: CDK7 (Human) Recombinant Protein (Q01)
Product description: Human CDK7 partial ORF ( AAH00834, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 1022
Gene name: CDK7
Gene alias: CAK1|CDKN7|MO15|STK1|p39MO15
Gene description: cyclin-dependent kinase 7
Genbank accession: BC000834
Immunogen sequence/protein sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQ
Protein accession: AAH00834
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00001022-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDK7 (Human) Recombinant Protein (Q01) now

Add to cart