Brand: | Abnova |
Reference: | H00001022-M01 |
Product name: | CDK7 monoclonal antibody (M01), clone 1G5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CDK7. |
Clone: | 1G5 |
Isotype: | IgG2a Kappa |
Gene id: | 1022 |
Gene name: | CDK7 |
Gene alias: | CAK1|CDKN7|MO15|STK1|p39MO15 |
Gene description: | cyclin-dependent kinase 7 |
Genbank accession: | BC000834 |
Immunogen: | CDK7 (AAH00834.1, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Protein accession: | AAH00834.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged CDK7 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |