CDK7 monoclonal antibody (M01), clone 1G5 View larger

CDK7 monoclonal antibody (M01), clone 1G5

H00001022-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK7 monoclonal antibody (M01), clone 1G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CDK7 monoclonal antibody (M01), clone 1G5

Brand: Abnova
Reference: H00001022-M01
Product name: CDK7 monoclonal antibody (M01), clone 1G5
Product description: Mouse monoclonal antibody raised against a full length recombinant CDK7.
Clone: 1G5
Isotype: IgG2a Kappa
Gene id: 1022
Gene name: CDK7
Gene alias: CAK1|CDKN7|MO15|STK1|p39MO15
Gene description: cyclin-dependent kinase 7
Genbank accession: BC000834
Immunogen: CDK7 (AAH00834.1, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Protein accession: AAH00834.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CDK7 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CDK7 monoclonal antibody (M01), clone 1G5 now

Add to cart