Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00001022-D01P |
Product name: | CDK7 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDK7 protein. |
Gene id: | 1022 |
Gene name: | CDK7 |
Gene alias: | CAK1|CDKN7|MO15|STK1|p39MO15 |
Gene description: | cyclin-dependent kinase 7 |
Genbank accession: | NM_001799.2 |
Immunogen: | CDK7 (NP_001790.1, 1 a.a. ~ 346 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Protein accession: | NP_001790.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CDK7 expression in transfected 293T cell line (H00001022-T01) by CDK7 MaxPab polyclonal antibody. Lane 1: CDK7 transfected lysate(39.00 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |