CDK7 purified MaxPab mouse polyclonal antibody (B01P) View larger

CDK7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about CDK7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001022-B01P
Product name: CDK7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CDK7 protein.
Gene id: 1022
Gene name: CDK7
Gene alias: CAK1|CDKN7|MO15|STK1|p39MO15
Gene description: cyclin-dependent kinase 7
Genbank accession: NM_001799.2
Immunogen: CDK7 (NP_001790.1, 1 a.a. ~ 346 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Protein accession: NP_001790.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001022-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CDK7 expression in transfected 293T cell line (H00001022-T01) by CDK7 MaxPab polyclonal antibody.

Lane 1: CDK7 transfected lysate(38.06 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDK7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart