CDK6 MaxPab mouse polyclonal antibody (B01) View larger

CDK6 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK6 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about CDK6 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001021-B01
Product name: CDK6 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CDK6 protein.
Gene id: 1021
Gene name: CDK6
Gene alias: MGC59692|PLSTIRE|STQTL11
Gene description: cyclin-dependent kinase 6
Genbank accession: NM_001259
Immunogen: CDK6 (NP_001250, 1 a.a. ~ 326 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Protein accession: NP_001250
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001021-B01-13-15-1.jpg
Application image note: Western Blot analysis of CDK6 expression in transfected 293T cell line (H00001021-T01) by CDK6 MaxPab polyclonal antibody.

Lane 1: CDK6 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDK6 MaxPab mouse polyclonal antibody (B01) now

Add to cart