Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDK5 monoclonal antibody (M01A), clone 1A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re,WB-Tr |
More info about CDK5 monoclonal antibody (M01A), clone 1A2
| Brand: | Abnova |
| Reference: | H00001020-M01A |
| Product name: | CDK5 monoclonal antibody (M01A), clone 1A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK5. |
| Clone: | 1A2 |
| Isotype: | IgM Kappa |
| Gene id: | 1020 |
| Gene name: | CDK5 |
| Gene alias: | PSSALRE |
| Gene description: | cyclin-dependent kinase 5 |
| Genbank accession: | BC005115 |
| Immunogen: | CDK5 (AAH05115, 195 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
| Protein accession: | AAH05115 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDK5 monoclonal antibody (M01A), clone 1A2. Western Blot analysis of CDK5 expression in human lung cancer. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Cyclin-dependent kinase 5 mediates pleiotrophin-induced endothelial cell migration.Lampropoulou E, Logoviti I, Koutsioumpa M, Hatziapostolou M, Polytarchou C, Skandalis SS, Hellman U, Fousteris M, Nikolaropoulos S, Choleva E, Lamprou M, Skoura A, Megalooikonomou V, Papadimitriou E. Sci Rep. 2018 Apr 12;8(1):5893. |