Brand: | Abnova |
Reference: | H00001019-M09 |
Product name: | CDK4 monoclonal antibody (M09), clone 8A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK4. |
Clone: | 8A10 |
Isotype: | IgG1 Kappa |
Gene id: | 1019 |
Gene name: | CDK4 |
Gene alias: | CMM3|MGC14458|PSK-J3 |
Gene description: | cyclin-dependent kinase 4 |
Genbank accession: | BC003644 |
Immunogen: | CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Protein accession: | AAH03644 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CDK4 monoclonal antibody (M09), clone 8A10 Western Blot analysis of CDK4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |