CDK4 monoclonal antibody (M06), clone 6D7 View larger

CDK4 monoclonal antibody (M06), clone 6D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK4 monoclonal antibody (M06), clone 6D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CDK4 monoclonal antibody (M06), clone 6D7

Brand: Abnova
Reference: H00001019-M06
Product name: CDK4 monoclonal antibody (M06), clone 6D7
Product description: Mouse monoclonal antibody raised against a partial recombinant CDK4.
Clone: 6D7
Isotype: IgG1 Kappa
Gene id: 1019
Gene name: CDK4
Gene alias: CMM3|MGC14458|PSK-J3
Gene description: cyclin-dependent kinase 4
Genbank accession: BC003644
Immunogen: CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Protein accession: AAH03644
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001019-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00001019-M06-1-1-1.jpg
Application image note: CDK4 monoclonal antibody (M06), clone 6D7 Western Blot analysis of CDK4 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDK4 monoclonal antibody (M06), clone 6D7 now

Add to cart