Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00001019-D01P |
Product name: | CDK4 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDK4 protein. |
Gene id: | 1019 |
Gene name: | CDK4 |
Gene alias: | CMM3|MGC14458|PSK-J3 |
Gene description: | cyclin-dependent kinase 4 |
Genbank accession: | NM_000075.2 |
Immunogen: | CDK4 (NP_000066.1, 1 a.a. ~ 303 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Protein accession: | NP_000066.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CDK4 expression in transfected 293T cell line (H00001019-T02) by CDK4 MaxPab polyclonal antibody. Lane 1: CDK4 transfected lysate(33.70 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |