CDK3 monoclonal antibody (M01), clone 3C12 View larger

CDK3 monoclonal antibody (M01), clone 3C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK3 monoclonal antibody (M01), clone 3C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CDK3 monoclonal antibody (M01), clone 3C12

Brand: Abnova
Reference: H00001018-M01
Product name: CDK3 monoclonal antibody (M01), clone 3C12
Product description: Mouse monoclonal antibody raised against a partial recombinant CDK3.
Clone: 3C12
Isotype: IgG1 Kappa
Gene id: 1018
Gene name: CDK3
Gene alias: -
Gene description: cyclin-dependent kinase 3
Genbank accession: NM_001258
Immunogen: CDK3 (NP_001249, 206 a.a. ~ 305 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Protein accession: NP_001249
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001018-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001018-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: HuR promotes breast cancer cell proliferation and survival via binding to CDK3 mRNA.Zhang Z, Huang A, Zhang A, Zhou C.
Biomed Pharmacother. 2017 May 10;91:788-795.

Reviews

Buy CDK3 monoclonal antibody (M01), clone 3C12 now

Add to cart