Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDH17 monoclonal antibody (M01), clone 1H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
More info about CDH17 monoclonal antibody (M01), clone 1H3
| Brand: | Abnova |
| Reference: | H00001015-M01 |
| Product name: | CDH17 monoclonal antibody (M01), clone 1H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH17. |
| Clone: | 1H3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1015 |
| Gene name: | CDH17 |
| Gene alias: | CDH16|FLJ26931|HPT-1|HPT1|MGC138218|MGC142024 |
| Gene description: | cadherin 17, LI cadherin (liver-intestine) |
| Genbank accession: | NM_004063 |
| Immunogen: | CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY |
| Protein accession: | NP_004054 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDH17 monoclonal antibody (M01), clone 1H3. Western Blot analysis of CDH17 expression in human intestinal wall. |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system.Su MC, Yuan RH, Lin CY, Jeng YM. Mod Pathol. 2008 Nov;21(11):1379-86. Epub 2008 Jun 13. |