CDH11 polyclonal antibody (A01) View larger

CDH11 polyclonal antibody (A01)

H00001009-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH11 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CDH11 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001009-A01
Product name: CDH11 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CDH11.
Gene id: 1009
Gene name: CDH11
Gene alias: CAD11|CDHOB|OB|OSF-4
Gene description: cadherin 11, type 2, OB-cadherin (osteoblast)
Genbank accession: NM_001797
Immunogen: CDH11 (NP_001788, 509 a.a. ~ 617 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Protein accession: NP_001788
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001009-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001009-A01-1-2-1.jpg
Application image note: CDH11 polyclonal antibody (A01), Lot # 051121JC01 Western Blot analysis of CDH11 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDH11 polyclonal antibody (A01) now

Add to cart