Brand: | Abnova |
Reference: | H00001006-A01 |
Product name: | CDH8 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CDH8. |
Gene id: | 1006 |
Gene name: | CDH8 |
Gene alias: | Nbla04261 |
Gene description: | cadherin 8, type 2 |
Genbank accession: | NM_001796 |
Immunogen: | CDH8 (NP_001787, 522 a.a. ~ 621 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM |
Protein accession: | NP_001787 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00001006-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00001006-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |