Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDH6 monoclonal antibody (M05), clone 2F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CDH6 monoclonal antibody (M05), clone 2F2
| Brand: | Abnova |
| Reference: | H00001004-M05 |
| Product name: | CDH6 monoclonal antibody (M05), clone 2F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH6. |
| Clone: | 2F2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1004 |
| Gene name: | CDH6 |
| Gene alias: | KCAD |
| Gene description: | cadherin 6, type 2, K-cadherin (fetal kidney) |
| Genbank accession: | NM_004932 |
| Immunogen: | CDH6 (NP_004923, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS |
| Protein accession: | NP_004923 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CDH6 expression in transfected 293T cell line by CDH6 monoclonal antibody (M05), clone 2F2. Lane 1: CDH6 transfected lysate(73.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |