Brand: | Abnova |
Reference: | H00001002-M01 |
Product name: | CDH4 monoclonal antibody (M01), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH4. |
Clone: | 2E2 |
Isotype: | IgG1 Kappa |
Gene id: | 1002 |
Gene name: | CDH4 |
Gene alias: | CAD4|FLJ22202|FLJ40547|MGC126700|MGC138355|RCAD |
Gene description: | cadherin 4, type 1, R-cadherin (retinal) |
Genbank accession: | NM_001794 |
Immunogen: | CDH4 (NP_001785, 635 a.a. ~ 734 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA |
Protein accession: | NP_001785 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CDH4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |