Brand: | Abnova |
Reference: | H00001000-M08 |
Product name: | CDH2 monoclonal antibody (M08), clone 6G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH2. |
Clone: | 6G6 |
Isotype: | IgG2a Kappa |
Gene id: | 1000 |
Gene name: | CDH2 |
Gene alias: | CD325|CDHN|CDw325|NCAD |
Gene description: | cadherin 2, type 1, N-cadherin (neuronal) |
Genbank accession: | NM_001792 |
Immunogen: | CDH2 (NP_001783, 807 a.a. ~ 906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
Protein accession: | NP_001783 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |