CDH2 monoclonal antibody (M05), clone 5E11 View larger

CDH2 monoclonal antibody (M05), clone 5E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH2 monoclonal antibody (M05), clone 5E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CDH2 monoclonal antibody (M05), clone 5E11

Brand: Abnova
Reference: H00001000-M05
Product name: CDH2 monoclonal antibody (M05), clone 5E11
Product description: Mouse monoclonal antibody raised against a partial recombinant CDH2.
Clone: 5E11
Isotype: IgG2a Kappa
Gene id: 1000
Gene name: CDH2
Gene alias: CD325|CDHN|CDw325|NCAD
Gene description: cadherin 2, type 1, N-cadherin (neuronal)
Genbank accession: NM_001792
Immunogen: CDH2 (NP_001783, 807 a.a. ~ 906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Protein accession: NP_001783
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001000-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDH2 monoclonal antibody (M05), clone 5E11 now

Add to cart