Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDH1 monoclonal antibody (M01), clone 3F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about CDH1 monoclonal antibody (M01), clone 3F4
| Brand: | Abnova |
| Reference: | H00000999-M01 |
| Product name: | CDH1 monoclonal antibody (M01), clone 3F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDH1. |
| Clone: | 3F4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 999 |
| Gene name: | CDH1 |
| Gene alias: | Arc-1|CD324|CDHE|ECAD|LCAM|UVO |
| Gene description: | cadherin 1, type 1, E-cadherin (epithelial) |
| Genbank accession: | NM_004360 |
| Immunogen: | CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV |
| Protein accession: | NP_004351 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between EGFR and CDH1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-CDH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Development of an AlphaLISA assay to quantify serum core-fucosylated E-cadherin as a metastatic lung adenocarcinoma biomarker.Wen CL, Chen KY, Chen CT, Chuang JG, Yang PC, Chow LP. J Proteomics. 2012 May 23. |