Brand: | Abnova |
Reference: | H00000995-M01A |
Product name: | CDC25C monoclonal antibody (M01A), clone 3B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC25C. |
Clone: | 3B11 |
Isotype: | IgG1 Kappa |
Gene id: | 995 |
Gene name: | CDC25C |
Gene alias: | CDC25 |
Gene description: | cell division cycle 25 homolog C (S. pombe) |
Genbank accession: | BC019089 |
Immunogen: | CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST |
Protein accession: | AAH19089 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDC25C monoclonal antibody (M01A), clone 3B11 Western Blot analysis of CDC25C expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |