CDC25C monoclonal antibody (M01A), clone 3B11 View larger

CDC25C monoclonal antibody (M01A), clone 3B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC25C monoclonal antibody (M01A), clone 3B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about CDC25C monoclonal antibody (M01A), clone 3B11

Brand: Abnova
Reference: H00000995-M01A
Product name: CDC25C monoclonal antibody (M01A), clone 3B11
Product description: Mouse monoclonal antibody raised against a partial recombinant CDC25C.
Clone: 3B11
Isotype: IgG1 Kappa
Gene id: 995
Gene name: CDC25C
Gene alias: CDC25
Gene description: cell division cycle 25 homolog C (S. pombe)
Genbank accession: BC019089
Immunogen: CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Protein accession: AAH19089
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000995-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000995-M01A-1-1-1.jpg
Application image note: CDC25C monoclonal antibody (M01A), clone 3B11 Western Blot analysis of CDC25C expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC25C monoclonal antibody (M01A), clone 3B11 now

Add to cart