Brand: | Abnova |
Reference: | H00000995-D01 |
Product name: | CDC25C MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDC25C protein. |
Gene id: | 995 |
Gene name: | CDC25C |
Gene alias: | CDC25 |
Gene description: | cell division cycle 25 homolog C (S. pombe) |
Genbank accession: | NM_001790 |
Immunogen: | CDC25C (AAH19089.1, 1 a.a. ~ 473 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP |
Protein accession: | AAH19089.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CDC25C transfected lysate using anti-CDC25C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CDC25C MaxPab mouse polyclonal antibody (B01) (H00000995-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |