CDC25C MaxPab mouse polyclonal antibody (B01) View larger

CDC25C MaxPab mouse polyclonal antibody (B01)

H00000995-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC25C MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CDC25C MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000995-B01
Product name: CDC25C MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CDC25C protein.
Gene id: 995
Gene name: CDC25C
Gene alias: CDC25
Gene description: cell division cycle 25 homolog C (S. pombe)
Genbank accession: NM_001790
Immunogen: CDC25C (NP_001781, 1 a.a. ~ 473 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Protein accession: NP_001781
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000995-B01-13-15-1.jpg
Application image note: Western Blot analysis of CDC25C expression in transfected 293T cell line (H00000995-T04) by CDC25C MaxPab polyclonal antibody.

Lane 1: CDC25C transfected lysate(52.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC25C MaxPab mouse polyclonal antibody (B01) now

Add to cart