SEPT7 purified MaxPab mouse polyclonal antibody (B01P) View larger

SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SEPT7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000989-B01P
Product name: SEPT7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SEPT7 protein.
Gene id: 989
Gene name: SEPT7
Gene alias: CDC10|CDC3|Nbla02942|SEPT7A
Gene description: septin 7
Genbank accession: NM_001788
Immunogen: SEPT7 (NP_001779, 1 a.a. ~ 418 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
Protein accession: NP_001779
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000989-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SEPT7 expression in transfected 293T cell line (H00000989-T02) by SEPT7 MaxPab polyclonal antibody.

Lane 1: SEPT7 transfected lysate(45.98 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEPT7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart