Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD151 monoclonal antibody (M02), clone 1B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about CD151 monoclonal antibody (M02), clone 1B2
| Brand: | Abnova |
| Reference: | H00000977-M02 |
| Product name: | CD151 monoclonal antibody (M02), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CD151. |
| Clone: | 1B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 977 |
| Gene name: | CD151 |
| Gene alias: | GP27|MER2|PETA-3|RAPH|SFA1|TSPAN24 |
| Gene description: | CD151 molecule (Raph blood group) |
| Genbank accession: | BC001374 |
| Immunogen: | CD151 (AAH01374.1, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGEFNEKKTTCGTVCLKYLLFTYNCCLWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
| Protein accession: | AAH01374.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CD151 monoclonal antibody (M02), clone 1B2. Western Blot analysis of CD151 expression in human pancreas. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |