CD79B purified MaxPab mouse polyclonal antibody (B01P) View larger

CD79B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD79B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CD79B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000974-B01P
Product name: CD79B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CD79B protein.
Gene id: 974
Gene name: CD79B
Gene alias: B29|IGB
Gene description: CD79b molecule, immunoglobulin-associated beta
Genbank accession: NM_000626
Immunogen: CD79B (NP_000617.1, 1 a.a. ~ 229 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Protein accession: NP_000617.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000974-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CD79B expression in transfected 293T cell line (H00000974-T02) by CD79B MaxPab polyclonal antibody.

Lane 1: CD79B transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD79B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart