Brand: | Abnova |
Reference: | H00000970-D01 |
Product name: | CD70 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CD70 protein. |
Gene id: | 970 |
Gene name: | CD70 |
Gene alias: | CD27L|CD27LG|TNFSF7 |
Gene description: | CD70 molecule |
Genbank accession: | NM_001252 |
Immunogen: | CD70 (NP_001243.1, 1 a.a. ~ 193 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
Protein accession: | NP_001243.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CD70 transfected lysate using anti-CD70 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD70 purified MaxPab mouse polyclonal antibody (B01P) (H00000970-B01P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |