CD59 MaxPab mouse polyclonal antibody (B04) View larger

CD59 MaxPab mouse polyclonal antibody (B04)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD59 MaxPab mouse polyclonal antibody (B04)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about CD59 MaxPab mouse polyclonal antibody (B04)

Brand: Abnova
Reference: H00000966-B04
Product name: CD59 MaxPab mouse polyclonal antibody (B04)
Product description: Mouse polyclonal antibody raised against a full-length human CD59 protein.
Gene id: 966
Gene name: CD59
Gene alias: 16.3A5|1F5|EJ16|EJ30|EL32|FLJ38134|FLJ92039|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MGC2354|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20
Gene description: CD59 molecule, complement regulatory protein
Genbank accession: BC001506
Immunogen: CD59 (AAH01506, 1 a.a. ~ 128 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Protein accession: AAH01506
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000966-B04-13-15-1.jpg
Application image note: Western Blot analysis of CD59 expression in transfected 293T cell line (H00000966-T06) by CD59 MaxPab polyclonal antibody.

Lane 1: CD59 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD59 MaxPab mouse polyclonal antibody (B04) now

Add to cart