CD40 MaxPab mouse polyclonal antibody (B01) View larger

CD40 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD40 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CD40 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000958-B01
Product name: CD40 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CD40 protein.
Gene id: 958
Gene name: CD40
Gene alias: Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene description: CD40 molecule, TNF receptor superfamily member 5
Genbank accession: NM_001250
Immunogen: CD40 (NP_001241, 1 a.a. ~ 277 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Protein accession: NP_001241
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000958-B01-13-15-1.jpg
Application image note: Western Blot analysis of CD40 expression in transfected 293T cell line (H00000958-T01) by CD40 MaxPab polyclonal antibody.

Lane 1: CD40 transfected lysate(30.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD40 MaxPab mouse polyclonal antibody (B01) now

Add to cart