H00000950-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00000950-M01 |
Product name: | SCARB2 monoclonal antibody (M01), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SCARB2. |
Clone: | 1C8 |
Isotype: | IgG2a Kappa |
Gene id: | 950 |
Gene name: | SCARB2 |
Gene alias: | AMRF|CD36L2|HLGP85|LIMPII|SR-BII |
Gene description: | scavenger receptor class B, member 2 |
Genbank accession: | NM_005506 |
Immunogen: | SCARB2 (NP_005497, 339 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN |
Protein accession: | NP_005497 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SCARB2 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |