CD19 monoclonal antibody (M02), clone 1C9 View larger

CD19 monoclonal antibody (M02), clone 1C9

H00000930-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD19 monoclonal antibody (M02), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CD19 monoclonal antibody (M02), clone 1C9

Brand: Abnova
Reference: H00000930-M02
Product name: CD19 monoclonal antibody (M02), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant CD19.
Clone: 1C9
Isotype: IgG1 Kappa
Gene id: 930
Gene name: CD19
Gene alias: B4|MGC12802
Gene description: CD19 molecule
Genbank accession: NM_001770
Immunogen: CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Protein accession: NP_001761
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000930-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000930-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CD19 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD19 monoclonal antibody (M02), clone 1C9 now

Add to cart