CD19 monoclonal antibody (M01A), clone 1G3 View larger

CD19 monoclonal antibody (M01A), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD19 monoclonal antibody (M01A), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CD19 monoclonal antibody (M01A), clone 1G3

Brand: Abnova
Reference: H00000930-M01A
Product name: CD19 monoclonal antibody (M01A), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant CD19.
Clone: 1G3
Isotype: IgG2a Kappa
Gene id: 930
Gene name: CD19
Gene alias: B4|MGC12802
Gene description: CD19 molecule
Genbank accession: NM_001770
Immunogen: CD19 (NP_001761, 98 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Protein accession: NP_001761
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000930-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000930-M01A-13-15-1.jpg
Application image note: Western Blot analysis of CD19 expression in transfected 293T cell line by CD19 monoclonal antibody (M01A), clone 1G3.

Lane 1: CD19 transfected lysate(61.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD19 monoclonal antibody (M01A), clone 1G3 now

Add to cart