Brand: | Abnova |
Reference: | H00000929-P01 |
Product name: | CD14 (Human) Recombinant Protein (P01) |
Product description: | Human CD14 full-length ORF ( AAH10507, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 929 |
Gene name: | CD14 |
Gene alias: | - |
Gene description: | CD14 molecule |
Genbank accession: | BC010507 |
Immunogen sequence/protein sequence: | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
Protein accession: | AAH10507 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00000929-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000929-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Necro-inflammatory response of pancreatic acinar cells in the pathogenesis of acute alcoholic pancreatitis.Gu H, Werner J, Bergmann F, Whitcomb DC, Buchler MW, Fortunato F Cell Death Dis. 2013 Oct 3;4:e816. doi: 10.1038/cddis.2013.354. |