CD14 MaxPab rabbit polyclonal antibody (D01) View larger

CD14 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD14 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about CD14 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00000929-D01
Product name: CD14 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CD14 protein.
Gene id: 929
Gene name: CD14
Gene alias: -
Gene description: CD14 molecule
Genbank accession: NM_000591
Immunogen: CD14 (AAH10507.1, 1 a.a. ~ 375 a.a) full-length human protein.
Immunogen sequence/protein sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Protein accession: AAH10507.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000929-D01-13-15-1.jpg
Application image note: Western Blot analysis of CD14 expression in transfected 293T cell line (H00000929-T02) by CD14 MaxPab polyclonal antibody.

Lane 1: CD14 transfected lysate(40.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CD14 MaxPab rabbit polyclonal antibody (D01) now

Add to cart