CD8B purified MaxPab rabbit polyclonal antibody (D01P) View larger

CD8B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD8B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CD8B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000926-D01P
Product name: CD8B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CD8B protein.
Gene id: 926
Gene name: CD8B
Gene alias: CD8B1|LYT3|Leu2|Ly3|MGC119115
Gene description: CD8b molecule
Genbank accession: NM_172213
Immunogen: CD8B (NP_757362.1, 1 a.a. ~ 243 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
Protein accession: NP_757362.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000926-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CD8B expression in transfected 293T cell line (H00000926-T02) by CD8B MaxPab polyclonal antibody.

Lane 1: CD8B transfected lysate(27.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD8B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart