CD7 purified MaxPab mouse polyclonal antibody (B01P) View larger

CD7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CD7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000924-B01P
Product name: CD7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CD7 protein.
Gene id: 924
Gene name: CD7
Gene alias: GP40|LEU-9|TP41|Tp40
Gene description: CD7 molecule
Genbank accession: NM_006137
Immunogen: CD7 (NP_006128.1, 1 a.a. ~ 240 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Protein accession: NP_006128.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000924-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CD7 expression in transfected 293T cell line (H00000924-T01) by CD7 MaxPab polyclonal antibody.

Lane 1: CD7 transfected lysate(26.4 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart