CD3Z monoclonal antibody (M01), clone 4A12-F6 View larger

CD3Z monoclonal antibody (M01), clone 4A12-F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD3Z monoclonal antibody (M01), clone 4A12-F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CD3Z monoclonal antibody (M01), clone 4A12-F6

Brand: Abnova
Reference: H00000919-M01
Product name: CD3Z monoclonal antibody (M01), clone 4A12-F6
Product description: Mouse monoclonal antibody raised against a full length recombinant CD3Z.
Clone: 4A12-F6
Isotype: IgG1 kappa
Gene id: 919
Gene name: CD247
Gene alias: CD3-ZETA|CD3H|CD3Q|CD3Z|T3Z|TCRZ
Gene description: CD247 molecule
Genbank accession: BC025703
Immunogen: CD3Z (AAH25703, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Protein accession: AAH25703
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000919-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000919-M01-3-10-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CD3Z on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CD3Z monoclonal antibody (M01), clone 4A12-F6 now

Add to cart