CD3E monoclonal antibody (M03), clone 3E12 View larger

CD3E monoclonal antibody (M03), clone 3E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD3E monoclonal antibody (M03), clone 3E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CD3E monoclonal antibody (M03), clone 3E12

Brand: Abnova
Reference: H00000916-M03
Product name: CD3E monoclonal antibody (M03), clone 3E12
Product description: Mouse monoclonal antibody raised against a full-length recombinant CD3E.
Clone: 3E12
Isotype: IgG2a Kappa
Gene id: 916
Gene name: CD3E
Gene alias: FLJ18683|T3E|TCRE
Gene description: CD3e molecule, epsilon (CD3-TCR complex)
Genbank accession: BC049847
Immunogen: CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Protein accession: AAH49847.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000916-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.09 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000916-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CD3E is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD3E monoclonal antibody (M03), clone 3E12 now

Add to cart