Brand: | Abnova |
Reference: | H00000916-M01 |
Product name: | CD3E monoclonal antibody (M01), clone 3H5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CD3E. |
Clone: | 3H5 |
Isotype: | IgG2b Kappa |
Gene id: | 916 |
Gene name: | CD3E |
Gene alias: | FLJ18683|T3E|TCRE |
Gene description: | CD3e molecule, epsilon (CD3-TCR complex) |
Genbank accession: | BC049847 |
Immunogen: | CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Protein accession: | AAH49847.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |