Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCNT2 monoclonal antibody (M03), clone 1H3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CCNT2 monoclonal antibody (M03), clone 1H3
| Brand: | Abnova |
| Reference: | H00000905-M03 |
| Product name: | CCNT2 monoclonal antibody (M03), clone 1H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCNT2. |
| Clone: | 1H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 905 |
| Gene name: | CCNT2 |
| Gene alias: | FLJ90560|MGC134840 |
| Gene description: | cyclin T2 |
| Genbank accession: | NM_058241 |
| Immunogen: | CCNT2 (NP_490595, 264 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET |
| Protein accession: | NP_490595 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CCNT2 monoclonal antibody (M03), clone 1H3. Western Blot analysis of CCNT2 expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |