CCNG1 monoclonal antibody (M01), clone 1E3 View larger

CCNG1 monoclonal antibody (M01), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNG1 monoclonal antibody (M01), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CCNG1 monoclonal antibody (M01), clone 1E3

Brand: Abnova
Reference: H00000900-M01
Product name: CCNG1 monoclonal antibody (M01), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant CCNG1.
Clone: 1E3
Isotype: IgG2a Kappa
Gene id: 900
Gene name: CCNG1
Gene alias: CCNG
Gene description: cyclin G1
Genbank accession: BC000196
Immunogen: CCNG1 (AAH00196, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIE
Protein accession: AAH00196
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000900-M01-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged CCNG1 is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CCNG1 monoclonal antibody (M01), clone 1E3 now

Add to cart