CCNG1 polyclonal antibody (A01) View larger

CCNG1 polyclonal antibody (A01)

H00000900-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNG1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CCNG1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000900-A01
Product name: CCNG1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CCNG1.
Gene id: 900
Gene name: CCNG1
Gene alias: CCNG
Gene description: cyclin G1
Genbank accession: BC000196
Immunogen: CCNG1 (AAH00196, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIE
Protein accession: AAH00196
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000900-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000900-A01-1-9-1.jpg
Application image note: CCNG1 polyclonal antibody (A01), Lot # 051115JCO1 Western Blot analysis of CCNG1 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CCNG1 polyclonal antibody (A01) now

Add to cart