Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00000894-M01 |
Product name: | CCND2 monoclonal antibody (M01), clone 3B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCND2. |
Clone: | 3B10 |
Isotype: | IgG1 kappa |
Gene id: | 894 |
Gene name: | CCND2 |
Gene alias: | KIAK0002|MGC102758 |
Gene description: | cyclin D2 |
Genbank accession: | BC010958 |
Immunogen: | CCND2 (AAH10958, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL |
Protein accession: | AAH10958 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 monoclonal antibody (M01), clone 3B10. Lane 1: CCND2 transfected lysate(33.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |