CBS monoclonal antibody (M01), clone 3E1 View larger

CBS monoclonal antibody (M01), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBS monoclonal antibody (M01), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about CBS monoclonal antibody (M01), clone 3E1

Brand: Abnova
Reference: H00000875-M01
Product name: CBS monoclonal antibody (M01), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant CBS.
Clone: 3E1
Isotype: IgG2a Kappa
Gene id: 875
Gene name: CBS
Gene alias: HIP4
Gene description: cystathionine-beta-synthase
Genbank accession: NM_000071
Immunogen: CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Protein accession: NP_000062
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000875-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000875-M01-3-32-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome.Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ.
Mol Pain. 2009 Aug 6;5:44.

Reviews

Buy CBS monoclonal antibody (M01), clone 3E1 now

Add to cart