Brand: | Abnova |
Reference: | H00000868-Q01 |
Product name: | CBLB (Human) Recombinant Protein (Q01) |
Product description: | Human CBLB partial ORF ( NP_733762, 21 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 868 |
Gene name: | CBLB |
Gene alias: | DKFZp686J10223|DKFZp779A0729|DKFZp779F1443|FLJ36865|FLJ41152|Nbla00127|RNF56 |
Gene description: | Cas-Br-M (murine) ecotropic retroviral transforming sequence b |
Genbank accession: | NM_170662 |
Immunogen sequence/protein sequence: | RILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGK |
Protein accession: | NP_733762 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00000868-Q01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00000868-Q01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |