> >>RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P)
RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,PLA-Ce

More info about RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000862-D01P
Product name: RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RUNX1T1 protein.
Gene id: 862
Gene name: RUNX1T1
Gene alias: AML1T1|CBFA2T1|CDR|ETO|MGC2796|MTG8|MTG8b|ZMYND2
Gene description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Genbank accession: NM_004349.2
Immunogen: RUNX1T1 (NP_004340.1, 1 a.a. ~ 577 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Protein accession: NP_004340.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000862-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RUNX1T1 expression in transfected 293T cell line (H00000862-T01) by RUNX1T1 MaxPab polyclonal antibody.

Lane 1: RUNX1T1 transfected lysate(64.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy RUNX1T1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart