RUNX1T1 MaxPab mouse polyclonal antibody (B02) View larger

RUNX1T1 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX1T1 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RUNX1T1 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00000862-B02
Product name: RUNX1T1 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human RUNX1T1 protein.
Gene id: 862
Gene name: RUNX1T1
Gene alias: AML1T1|CBFA2T1|CDR|ETO|MGC2796|MTG8|MTG8b|ZMYND2
Gene description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Genbank accession: NM_004349.2
Immunogen: RUNX1T1 (NP_004340.1, 1 a.a. ~ 577 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Protein accession: NP_004340.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000862-B02-13-15-1.jpg
Application image note: Western Blot analysis of RUNX1T1 expression in transfected 293T cell line (H00000862-T01) by RUNX1T1 MaxPab polyclonal antibody.

Lane 1: RUNX1T1 transfected lysate(63.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RUNX1T1 MaxPab mouse polyclonal antibody (B02) now

Add to cart