RUNX1T1 polyclonal antibody (A01) View larger

RUNX1T1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX1T1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RUNX1T1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000862-A01
Product name: RUNX1T1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RUNX1T1.
Gene id: 862
Gene name: RUNX1T1
Gene alias: AML1T1|CBFA2T1|CDR|ETO|MGC2796|MTG8|MTG8b|ZMYND2
Gene description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Genbank accession: NM_004349
Immunogen: RUNX1T1 (NP_004340, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG
Protein accession: NP_004340
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000862-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RUNX1T1 polyclonal antibody (A01) now

Add to cart