Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RUNX1 monoclonal antibody (M06), clone 2C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about RUNX1 monoclonal antibody (M06), clone 2C10
| Brand: | Abnova |
| Reference: | H00000861-M06 |
| Product name: | RUNX1 monoclonal antibody (M06), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX1. |
| Clone: | 2C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 861 |
| Gene name: | RUNX1 |
| Gene alias: | AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB |
| Gene description: | runt-related transcription factor 1 |
| Genbank accession: | NM_001001890 |
| Immunogen: | RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP |
| Protein accession: | NP_001001890.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Megakaryocytic expression of miRNA 10a, 17-5p, 20a and 126 in Philadelphia chromosome-negative myeloproliferative neoplasm.Hussein K, Dralle W, Theophile K, Kreipe H, Bock O. Ann Hematol. 2009 Apr;88(4):325-32. Epub 2008 Sep 5. |