RUNX1 monoclonal antibody (M06), clone 2C10 View larger

RUNX1 monoclonal antibody (M06), clone 2C10

H00000861-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX1 monoclonal antibody (M06), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about RUNX1 monoclonal antibody (M06), clone 2C10

Brand: Abnova
Reference: H00000861-M06
Product name: RUNX1 monoclonal antibody (M06), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
Clone: 2C10
Isotype: IgG2a Kappa
Gene id: 861
Gene name: RUNX1
Gene alias: AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB
Gene description: runt-related transcription factor 1
Genbank accession: NM_001001890
Immunogen: RUNX1 (NP_001001890.1, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Protein accession: NP_001001890.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000861-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000861-M06-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Megakaryocytic expression of miRNA 10a, 17-5p, 20a and 126 in Philadelphia chromosome-negative myeloproliferative neoplasm.Hussein K, Dralle W, Theophile K, Kreipe H, Bock O.
Ann Hematol. 2009 Apr;88(4):325-32. Epub 2008 Sep 5.

Reviews

Buy RUNX1 monoclonal antibody (M06), clone 2C10 now

Add to cart