RUNX2 (Human) Recombinant Protein (Q01) View larger

RUNX2 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about RUNX2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00000860-Q01
Product name: RUNX2 (Human) Recombinant Protein (Q01)
Product description: Human RUNX2 partial ORF ( NP_004339, 251 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 860
Gene name: RUNX2
Gene alias: AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1
Gene description: runt-related transcription factor 2
Genbank accession: NM_004348
Immunogen sequence/protein sequence: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Protein accession: NP_004339
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000860-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RUNX2 (Human) Recombinant Protein (Q01) now

Add to cart